 |
primary-0036 |
BCAS1 |
AB_10839529 |
Anti-NaBC1 Antibody |
monoclonal |
raised against amino acids 365-571 of NaBC1 of human origin |
|
Santa Cruz Biotechnology |
sc-136342 |
|
primary-0035 |
CNP |
AB_2728547 |
Purified anti-Myelin CNPase Antibody |
monoclonal |
|
|
BioLegend |
836403 |
|
primary-0034 |
MBP |
AB_305869 |
Anti-Myelin Basic Protein antibody |
monoclonal |
Full length protein corresponding to Cow Myelin Basic Protein. |
|
Abcam |
ab7349 |
|
primary-0033 |
PLP1 |
AB_2237198 |
Myelin Proteolipid Protein antibody |
monoclonal |
Synthetic peptide GRGTKF corresponding to C terminal region of myelin proteolipid protein |
|
Bio Rad |
MCA839G |
|
primary-0032 |
TPPP |
AB_2050408 |
Recombinant Anti-TPPP antibody |
monoclonal |
Synthetic peptide within Human TPPP. The exact sequence is proprietary. |
|
Abcam |
ab92305 |
|
primary-0031 |
MAG/GMA |
AB_2042411 |
Anti-MAG/GMA antibody |
monoclonal |
Recombinant fragment corresponding to Human MAG/GMA aa 119-208. |
|
Abcam |
ab89780 |
|
primary-0030 |
GFAP |
AB_10013382 |
Glial Fibrillary Acidic Protein (Multipurpose) antibody |
polyclonal |
|
|
Agilent (Dako) |
Z0334 |
|
primary-0027 |
|
AB_570666 |
Anti-Olig-2 Antibody |
polyclonal |
|
|
Millipore |
AB9610 |
|
primary-0026 |
|
AB_839504 |
Anti Iba1, Rabbit antibody |
polyclonal |
|
|
FUJIFILM Wako Shibayagi |
019-19741 |
|
primary-0025 |
|
AB_2057371 |
Anti-APC (Ab-7) Mouse mAb (CC-1) antibody |
monoclonal |
|
|
Millipore |
OP80 |
|
primary-0012 |
TUBA1A |
AB_301787 |
Anti-alpha Tubulin antibody - Microtubule Marker |
polyclonal |
|
|
Abcam |
ab15246 |
|
primary-0011 |
|
|
SARS-CoV-2 (2019-nCoV) Spike RBD Antibody, Rabbit PAb, Antigen Affinity Purified |
polyclonal |
Recombinant SARS-CoV-2 / 2019-nCoV Spike/RBD Protein (Catalog#40592-V05H) |
|
SinoBiological |
40592-T62 |
|
primary-0010 |
OLIG2 |
AB_494617 |
OLIG2 anti-human rabbit IgG affinity purify |
polyclonal |
Synthetic peptide in portion of C-terminus of Human Olig2 |
|
Immuno-Biological Laboratories (IBL) |
18953 |
|
primary-0009 |
|
|
Anti-SARS spike glycoprotein antibody [3A2] - Coronavirus |
monoclonal |
|
|
Abcam |
ab272420 |
|
primary-0008 |
NRP1 |
AB_2282634 |
neuropilin Antikörper (A-12) |
monoclonal |
amino acid sequence 570-855 of neuropilin in species human |
|
Santa Cruz Biotechnology |
sc-5307 |
|
primary-0007 |
ACE2 |
AB_355722 |
Human/Mouse/Rat/Hamster ACE-2 Antibody |
polyclonal |
Mouse myeloma cell line NS0-derived recombinant human ACE-2, Gln18-Ser740, Accession # Q9BYF1 |
|
R&D Systems |
AF933 |
|
primary-0006 |
AQP4 |
AB_2039734 |
Anti-Aquaporin 4 (AQP4) (249-323) Antibody |
polyclonal |
GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV |
|
Alomone Labs |
AQP-004 |
|
primary-0005 |
PECAM1 |
AB_2801330 |
PECAM-1 Antikörper (H-3) |
monoclonal |
aa 699-727 at the C-terminus |
|
Santa Cruz Biotechnology |
sc-376764 |
|
primary-0004 |
COL4A1 |
AB_2721907 |
Goat Anti-Type IV Collagen-UNLB |
polyclonal |
|
|
SouthernBiotech |
1340-01 |
|
primary-0003 |
|
AB_221570 |
GFP Polyclonal Antibody |
polyclonal |
The GFP was isolated directly from the jellyfish Aequorea victoria. |
|
|
A-6455 |
|
primary-0002 |
NeuN |
AB_11205760 |
Anti-NeuN Antibody |
polyclonal |
GST-tagged recombinant fragment corresponding to the first 97 amino acids from the N-terminal region of murine NeuN. |
|
Milipore |
ABN91 |
|
primary-0001 |
NRP1 |
AB_1640739 |
anti-neuropilin-1 |
monoclonal |
|
|
Abcam |
AB81321 |