 |
primary-0108 |
NRP1 |
AB_1640739 |
anti-neuropilin-1 |
monoclonal |
|
|
Abcam |
AB81321 |
 |
primary-0104 |
PARP1 |
AB_10699459 |
poly(ADP-ribose) polymerase 1 |
monoclonal |
large fragment (89 kDa) of human PARP1 protein produced by caspase cleavage. |
|
Cell Signaling Technology |
5625 |
 |
primary-0103 |
GALNS |
AB_11152499 |
GALNS Polyclonal Antibody |
polyclonal |
|
|
Thermo Fisher Scientific (Invitrogen) |
PA5-22098 |
 |
primary-0102 |
ARSA |
AB_1078220 |
Anti-ARSA antibody produced in rabbit |
polyclonal |
LLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQ |
|
|
HPA005554 |
 |
primary-0101 |
NICA |
AB_477259 |
Anti-Nicastrin antibody produced in rabbit |
polyclonal |
synthetic peptide corresponding to the C-terminus of human nicastrin (amino acids 693-709) conjugated to KLH. |
|
|
N1660 |
 |
primary-0100 |
APP |
AB_2289606 |
Recombinant Anti-Amyloid Precursor Protein antibody [Y188] |
monoclonal |
Synthetic peptide. This information is proprietary to Abcam and/or its suppliers. |
|
Abcam |
ab32136 |
 |
primary-0097 |
TREM2 |
AB_2799888 |
TREM2 (E7P8J) Rabbit mAb (Carboxy-terminal Antigen) |
monoclonal |
|
|
Cell Signaling Technology |
76765 |
 |
primary-0096 |
BACE1 |
AB_1903900 |
BACE1 (D10E5) Rabbit mAb |
monoclonal |
|
|
Cell Signaling Technology |
5606 |
 |
primary-0091 |
PSN2 |
AB_882202 |
Recombinant Anti-Presenilin 2/AD5 antibody [EP1515Y] |
monoclonal |
Synthetic peptide within Human Presenilin 2/AD5 aa 300-400 (C terminal). The exact sequence is proprietary. |
|
Abcam |
ab51249 |
 |
primary-0090 |
ApoE |
AB_2798191 |
ApoE (pan) (D7I9N) Rabbit mAb |
monoclonal |
|
|
Cell Signaling Technology |
13366 |
 |
primary-0089 |
APP |
AB_2798041 |
β-Amyloid (1-42) (D3E10) Rabbit mAb |
unknown |
|
|
Cell Signaling Technology |
12843 |
 |
primary-0088 |
APP |
AB_2056967 |
APP antibody |
polyclonal |
Synthetic peptide corresponding to AA 756 to 770 from rat APP (UniProt Id: P08592) |
|
Synaptic Systems |
127 003 |
 |
primary-0087 |
APP |
AB_258409 |
Anti-Amyloid Precursor Protein, C-Terminal antibody produced in rabbit |
polyclonal |
|
|
Sigma-Aldrich |
A8717 |
 |
primary-0086 |
GFAP |
AB_563739 |
Anti-Glial Fibrillary Acidic Protein Monoclonal Antibody, Unconjugated |
monoclonal |
|
|
Leica Biosystems |
NCL-GFAP-GA5 |
 |
primary-0085 |
BACE1 |
|
Recombinant Anti-BACE1 antibody [EPR19523] (ab183612) |
monoclonal |
|
|
Abcam |
ab183612 |
 |
primary-0084 |
CNP |
AB_2665789 |
Monoclonal Anti-CNP Antibody |
monoclonal |
|
|
Atlas Antibodies |
AMAb91072 |
 |
primary-0083 |
|
AB_2564653 |
Purified anti-β-Amyloid, 1-16 Antibody (Previously Covance catalog# SIG-39320) |
monoclonal |
|
|
BioLegend |
803001 |
 |
primary-0082 |
Iba1 |
AB_839504 |
Anti Iba1, Rabbit (for Immunocytochemistry) |
polyclonal |
Synthetic peptide (Iba1 C-terminal sequence) |
|
FUJIFILM Wako Shibayagi |
019-19741 |
 |
primary-0076 |
TFAM |
AB_10717737 |
TFAM MaxPab rabbit polyclonal antibody (D01) |
polyclonal |
TFAM (NP_003192.1, 1 a.a. ~ 246 a.a) full-length human protein. |
|
Abnova |
H00007019-D01 |
 |
primary-0075 |
BrdU |
AB_305426 |
Anti-BrdU antibody [BU1/75 (ICR1)] - Proliferation Marker |
monoclonal |
The details of the immunogen for this antibody are not available. |
|
Abcam |
ab6326 |
 |
primary-0074 |
|
AB_470907 |
Anti-ds DNA antibody [35I9 DNA] - BSA and Azide free |
monoclonal |
The details of the immunogen for this antibody are not available. |
|
Abcam |
ab27156 |
 |
primary-0073 |
IMMT |
AB_2127193 |
Mitofilin antibody |
polyclonal |
Mitofilin fusion protein Ag0102 |
|
Proteintech |
10179-1-AP |
 |
primary-0072 |
|
AB_221544 |
Alexa Fluor 488 Polyclonal Antibody |
polyclonal |
Alexa Fluor 488 coupled to carrier protein |
|
Thermo Fisher Scientific (Invitrogen) |
A-11094 |
 |
primary-0071 |
NEFH |
AB_477257 |
Anti-Neurofilament 200 (Phos. and Non-Phos.) antibody |
monoclonal |
C-terminal segment of enzymatically dephosphorylated pig neurofilament 200. |
|
Sigma-Aldrich |
N0142 |
 |
primary-0070 |
AQP4 |
AB_258270 |
Anti-Water Channel Aquaporin 4 antibody |
polyclonal |
recombinant fusion protein corresponding to residues 249-323 of rat AQP4 fused to GST. |
|
Sigma-Aldrich |
A5971 |