| Antigen symbol |
P2RY12 |
| Antibody Registry ID(s) |
AB_2810254 |
| Name |
P2Y12/P2RY12 Antibody |
| Alternative name |
SP1999 |
| Lab ID |
|
| Tag / Fluorophore |
|
| Raised in |
|
| Reacts with |
Human, canine, feline |
| Clone |
|
| Isotype |
IgG |
| Clonality |
polyclonal |
| Demasking |
unknown |
| Antigen |
Against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM |
| Crafted By |
company |
| Company / Manufacturer |
Novus Biologicals |
| Catalog no. |
NBP2-33870 |
| Lot no. |
|
| Description |
Western Blot 0.04 - 0.4 ug/ml
Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL
Immunohistochemistry 1:1000 - 1:2500
Immunohistochemistry-Frozen
Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Localization |
|
| Storage instruction |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Receipt date |
2021-11-11 00:00:00 |
| Preparation date |
2021-11-11 00:00:00 |
| Created by |
|
| Last modified |
|